Description

  • Product name

    Recombinant Human RGR protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAETSALPTGFGELEVLAVGMVLLVEALSGLSLNTLTIFSFCKTPELRTP CHLLVLSLALADSGISLNALVAATSSLLRVSHRRWPYGSDGCQAHGFQGF VTALASICSSAAIAWGRYHHYCTRSQLAWNSAVSLVLFVWLSSAFWAALP LLGWGHYDYEPLGTCCTLDYSKGDRNFTSFLFTMSFFNFAMPLFITITSY SLMEQKLGKSGHLQVNTTLPARTLLLGWGPYAILYLYAVIADVTSISPKL QMVPALIAKMVPTINAINYALGNEMVCRGIWQCLSPQKREKDRTK
    • Amino acids

      1 to 295
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hRGR
    • Ral GDS related protein
    • Retinal G protein coupled receptor
    • RGR-opsin
    • RP44
    • RPE retinal G protein coupled receptor
    see all
  • Relevance

    RGR is a putative retinal G-protein coupled receptor and is a member of the opsin subfamily of the 7 transmembrane, G-protein coupled receptor 1 family. Like other opsins which bind retinaldehyde, it contains a conserved lysine residue in the seventh transmembrane domain. RGR acts as a photoisomerase to catalyze the conversion of all-trans-retinal to 11-cis-retinal (the reverse isomerization occurs with rhodopsin in retinal photoreceptor cells). RGR is exclusively expressed in tissue adjacent to retinal photoreceptor cells, the retinal pigment epithelium and Mueller cells. This gene may be associated with autosomal recessive and autosomal dominant retinitis pigmentosa (arRP and adRP, respectively). Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Cellular localization

    Cell Membrane; Multi-pass membrane protein

Images

  • ab159341 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159341 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159341.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up