Description

  • Product name

    Recombinant Human RGS17 / RGSZ2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGE NAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFRE FLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVS LDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFV ESTAGSSSES
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      1 to 210

Specifications

Our Abpromise guarantee covers the use of ab132129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hRGS17
    • Regulator of G protein signalling 17
    • Regulator of G protein signalling Z2
    • Regulator of G-protein signaling 17
    • RGS-17
    • RGS17
    • RGS17_HUMAN
    • RGSZ2
    see all
  • Function

    Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G-protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.
  • Tissue specificity

    Predominantly expressed in the cerebellum. Also expressed in the cortex and medulla. Weakly expressed in a number of peripheral tissues notably spleen, lung and leukocytes.
  • Sequence similarities

    Contains 1 RGS domain.
  • Post-translational
    modifications

    Fatty acylated. Heavily palmitoylated in the cysteine string motif.
    N- and O-glycosylated in synapsomal membranes.
    Serine phosphorylated in synapsomal membranes.
    Sumoylated by SUMO1 and SUM02 in synaptosomes. The sumoylated forms act as a scaffold for sequestering mu-opioid receptor-activated G(alpha) subunits.
  • Cellular localization

    Membrane. Nucleus. Cytoplasm. Shuttles between the cytoplasm/cell membrane and the nucleus. Anchored to the membrane through palmitoylation.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132129 stained with Coomassie Blue.

References

ab132129 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up