Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      NQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRN AFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS
    • Amino acids

      78 to 176
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • G(z)GAP
    • Gz selective GTPase activating protein
    • Gz-GAP
    • Gz-selective GTPase-activating protein
    • HGNC:14600
    • Regulator of G protein signaling 20
    • Regulator of G-protein signaling 20
    • Regulator of G-protein signaling Z1
    • Regulator of Gz selective protein signaling 1
    • Regulator of Gz-selective protein signaling 1
    • RGS20
    • RGS20_HUMAN
    • RGSZ1
    • ZGAP1
    see all
  • Function

    Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G-protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.
  • Tissue specificity

    Isoform 5 is expressed in brain at high levels in the caudate nucleus and temporal lobe.
  • Sequence similarities

    Contains 1 RGS domain.
  • Post-translational
    modifications

    Fatty acylated. Heavily palmitoylated in the cysteine string motif.
    N- and O-glycosylated in synapsomal membranes.
    Serine phosphorylated in synapsomal membranes.
    Sumoylated by SUMO1 and SUM02 in synaptosomes. The sumoylated forms act as a scaffold for sequestering mu-opioid receptor-activated G(alpha) subunits.
  • Cellular localization

    Membrane. Nucleus. Cytoplasm. Shuttles between the cytoplasm/cell membrane and the nucleus (By similarity). Anchored to the membrane through palmitoylation.
  • Information by UniProt

Images

  • ab160106 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160106 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160106.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up