Overview

  • Product name
    Recombinant Human RHBDF1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSEARRDSTSSLQRKKPPWLKLDIPSAVPLTAEEPSFLQPLRRQAFLRSV SMPAETAHISSPHHELRRPVLQRQTSITQTIRRGTADWFGVSKDSDSTQK WQRKSIRHCSQRYGKLKPQVLRELDLPSQDNVSLTSTETPPPLYVGPCQL GMQKIIDPLARGRAFRVADDTAEGLSAPHTPVTPGAASLCSFSSSRSGFH RLPRRRKRESVAKMSFRAAAALMKGRSVRDGTFRRARRRSFTPASFLEED TTDFPDELDTSFFAREGILHEELSTYPDEVFESPSEAALKDWEKAPEQAD LTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVRLRQEVVSTAGP RRGQRIAVPVRKLFAREKRPYGLGMVGRLTNRTYRKRIDSFVKRQIEDMD DHRPFFTYWLTFVHSLVTILAVCIYGIAPVGFSQHETVDSVLRNRGVYEN VKYVQQENFWIGPSSEALIHLGAKFSPCMRQDPQVHSFIRSAREREKHSA CCVRNDRSGCVQTSEEECSSTLAVWVKWPIHPSAPELAGHKRQFGSVCHQ DPRVCDEPSSEDPHEWPEDITKWPICTKNSAGNHTNHPHMDCVITGRPCC IGTKGRCEITSREYCDFMRGYFHEEATLCSQVHCMDDVCGLLPFLNPEVP DQFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSG VTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFK LLAVVLFLFTFGLLPWIDNFAHISGFISGLFLSFAFLPYISFGKFDLYRK RCQIIIFQVVFLGLLAGLVVLFYVYPVRCEWCEFLTCIPFTDKFCEKYEL DAQLH
    • Amino acids
      1 to 855
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C 16 orf 8
    • C16orf8
    • chromosome 16 open reading frame 8
    • Dist 1
    • Dist1
    • EGFR RS
    • epidermal growth factor receptor related sequence
    • FLJ 2235
    • FLJ 22357
    • FLJ2235
    • FLJ22357
    • gene 89
    • gene 90
    • h Dist 1
    • hDist 1
    • hDist1
    • RHBDF 1
    • Rhomboid 5 homolog 1
    • rhomboid 5 homolog 1 (Drosophila)
    • rhomboid family 1
    see all
  • Relevance
    RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.
  • Cellular localization
    Endoplasmic reticulum and Golgi Apparatus

Images

  • ab163812 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163812 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up