Overview

  • Product name
    Recombinant Human RHBDL1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRVEDGGTTEELEDWDPGTSALPAPGIKQGPREQTGTGPLSQKCWEPEP DAPSQPGPALWSRGRARTQALAGGSSLQQLDPENTGFIGADTFTGLVHSH
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160300 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • RHBDL
    • RHBDL 1
    • RHBDL1
    • RHBL1_HUMAN
    • Rhomboid (veinlet Drosophila) like
    • Rhomboid drosophila homolog of
    • Rhomboid like protein 1
    • Rhomboid related protein 1
    • Rhomboid veinlet like 1
    • Rhomboid-like protein 1
    • Rhomboid-related protein 1
    • RRP
    see all
  • Function
    May be involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors.
  • Tissue specificity
    Detected in heart, brain, skeletal muscle and kidney.
  • Sequence similarities
    Belongs to the peptidase S54 family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160300 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160300 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160300.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up