Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAWNTNLRWRLPLTCLLLQVIMVILFGVFVRYDFEADAHWWSERTHKNLS DMENEFYYRYPSFQDVHVMVFVGFGFLMTFLQRYGFSAVGFNFLLAAFGI QWALLMQGWFHFLQDRYIVVGVENLINADFCVASVCVAFGAVLGKVSPIQ LLIMTFFQVTLFAVNEFILLNLLKVKDAGGSMTIHTFGAYFGLTVTRILY RRNLEQSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAA INTYCSLAACVLTSVAISSALHKKGKLDMVHIQNATLAGGVAVGTAAEMM LMPYGALIIGFVCGIISTLGFVYLTPFLESRLHIQDTCGINNLHGIPGII GGIVGAVTAASASLEVYGKEGLVHSFDFQGFNGDWTARTQGKFQIYGLLV TLAMALMGGIIVGLILRLPFWGQPSDENCFEDAVYWEMPEGNSTVYIPED PTFKPSGPSVPSVPMVSPLPMASSVPLVP
    • Amino acids
      1 to 479
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162563 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ammonium transporter Rh type C
    • C15orf6
    • CDRC2
    • chromosome 15 open reading frame 6
    • PDRC2
    • Rh family type C glycoprotein
    • Rh glycoprotein kidney
    • Rh type C glycoprotein
    • rhcg
    • RHCG_HUMAN
    • Rhesus blood group family type C glycoprotein
    • Rhesus blood group, C glycoprotein
    • RHGK
    • SLC42A3
    • Tumor-related protein DRC2
    see all
  • Function
    Functions as an electroneutral and bidirectional ammonium transporter. May regulate transepithelial ammonia secretion.
  • Tissue specificity
    Expressed in brain, testis, placenta, pancreas, esophagus and prostate. Expressed in squamous epithelial tissues (at protein level). According to PubMed:11062476, specifically expressed in kidney.
  • Sequence similarities
    Belongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily.
  • Developmental stage
    Specifically expressed in fetal kidney.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Apical cell membrane. Also detected at the basolateral membrane and in subapical vesicles.
  • Information by UniProt

Images

  • ab162563 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162563 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162563.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up