Description

  • Product name

    Recombinant Human RhD protein
    See all RhD proteins and peptides
  • Expression system

    Escherichia coli
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTALGNLRMVI SNIFNTDY
    • Amino acids

      108 to 165

Specifications

Our Abpromise guarantee covers the use of ab80087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Constituent: PBS

  • Reconstitution
    Redissolve the powder with 1ml sterile water.

General Info

  • Alternative names

    • Blood group Rh(D) polypeptide
    • Blood group--Rhesus system D polypeptide
    • CD240D
    • D antigen (DCS)
    • DIIIc
    • MGC165007
    • RH
    • Rh blood group antigen Evans
    • Rh blood group D antigen
    • Rh polypeptide 2
    • RH30
    • Rh4
    • RHCED
    • Rhd
    • RHD_HUMAN
    • RhDCw
    • RHDel
    • RHDVA(TT)
    • Rhesus blood group D antigen allele DIII type 7
    • Rhesus D antigen
    • Rhesus system D polypeptide
    • RhII
    • RhK562-II
    • RhPI
    • RHPII
    • RHXIII
    see all
  • Function

    May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
  • Tissue specificity

    Restricted to tissues or cell lines expressing erythroid characters.
  • Sequence similarities

    Belongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 20% SDS PAGE showing ab80087 at approximately 13kDa.

References

ab80087 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting us and your interest in our products.

The RhD protein (His tag) (ab80087) is not the full length RhD protein but a truncation of the residues 108-165 of the human protein(SwissProt reference Q02161) with an N-terminal His tag. The sequence is as follows:

ITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEV TALGNLRMVISNIFNTDY

The likelihood of this protein being useful in your experiment or not would be dependent on if the antibodies you are hoping to detect bind this region of the protein or not. As we have not tried the protein in this application we would not be able to guarantee its performance.

Unfortunatelyaswe carry over 70,000 products, it isn't feasible for us to keep small sample sizes of our products.



I hope this information has been of help. If you have any further questions, please do not hesitate to contact us again.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up