Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVN GQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIH GKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSA KENQTAVDVFRRIILEAEKMDGAASQGKSSCSVM
    • Molecular weight
      20 kDa
    • Amino acids
      1 to 184
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173075 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.24% Tris, 0.31% Glutathione

General Info

  • Alternative names
    • Ras homolog enriched in brain 2, formerly
    • GTP binding protein Rheb
    • GTP-binding protein Rheb
    • MGC111559
    • Ras homolog enriched in brain
    • Ras homolog enriched in brain 2
    • Rheb
    • RHEB 2
    • RHEB_HUMAN
    • RHEB2
    • RHEB2, formerly
    see all
  • Function
    Stimulates the phosphorylation of S6K1 and EIF4EBP1 through activation of mTORC1 signaling. Activates the protein kinase activity of mTORC1. Has low intrinsic GTPase activity.
  • Tissue specificity
    Ubiquitous. Highest levels observed in skeletal and cardiac muscle.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rheb family.
  • Post-translational
    modifications
    Farnesylation is important for efficiently activating mTORC1-mediated signaling.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab173075 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173075.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up