Description

  • Product name

    Recombinant Human RHEB protein (BSA and azide free)
    See all RHEB proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVN GQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIH GKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSA KENQTAVDVFRRIILEAEKMDGAASQGKSSCSVM
    • Predicted molecular weight

      20 kDa
    • Amino acids

      1 to 184
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173075 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.24% Tris, 0.31% Glutathione

General Info

  • Alternative names

    • Ras homolog enriched in brain 2, formerly
    • GTP binding protein Rheb
    • GTP-binding protein Rheb
    • MGC111559
    • Ras homolog enriched in brain
    • Ras homolog enriched in brain 2
    • Rheb
    • RHEB 2
    • RHEB_HUMAN
    • RHEB2
    • RHEB2, formerly
    see all
  • Function

    Stimulates the phosphorylation of S6K1 and EIF4EBP1 through activation of mTORC1 signaling. Activates the protein kinase activity of mTORC1. Has low intrinsic GTPase activity.
  • Tissue specificity

    Ubiquitous. Highest levels observed in skeletal and cardiac muscle.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rheb family.
  • Post-translational
    modifications

    Farnesylation is important for efficiently activating mTORC1-mediated signaling.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab173075 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173075.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up