Description

  • Product name

    Recombinant Human Rheb2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPLVRYRKVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLG KDEFHLHLVDTAGQDEYSILPYSFIIGVHGYVLVYSVTSLHSFQVIESLY QKLHEGHGKTRVPVVLVGNKADLSPEREVQAVEGKKLAESWGATFMESSA RENQLTQGIFTKVIQEIARVENSYGQERRCHLM
    • Amino acids

      1 to 183
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165171 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as RHEBL1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ25797
    • GTPase RhebL1
    • MGC34869
    • Ras homolog enriched in brain like 1
    • Ras homolog enriched in brain like 1 c
    • Ras homolog enriched in brain like protein 1
    • Ras homolog enriched in brain like-1 c
    • Ras homolog enriched in brain-like protein 1
    • REBL1_HUMAN
    • Rheb like protein 1
    • Rheb-like protein 1
    • Rheb2
    • Rhebl1
    • RhebL1c
    see all
  • Function

    Binds GTP and exhibits intrinsic GTPase activity. May activate NF-kappa-B-mediated gene transcription. Promotes signal transduction through MTOR, activates RPS6KB1, and is a downstream target of the small GTPase-activating proteins TSC1 and TSC2.
  • Tissue specificity

    Ubiquitously expressed. Expression increased at least 2-fold in several tumor cell lines.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rheb family.
  • Cellular localization

    Cell membrane. Cytoplasm.
  • Information by UniProt

Images

  • ab165171 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165171 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165171.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up