Recombinant Human Rho guanine exchange factor 16 protein (ab162120)

Overview

  • Product name
    Recombinant Human Rho guanine exchange factor 16 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGA SQRFFEDLEQRHKAQVLVEDISDILEEHAEKYFHPYIAYCSNEVYQQRTL QKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLC LKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFS KVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVT KKKSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLL RNSEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITK AFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFIT SRVAVEGNVRRMERLRVETDV
    • Amino acids
      1 to 421
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162120 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARHGEF 16
    • ARHGEF16
    • ARHGG_HUMAN
    • Ephexin 4
    • Ephexin-4
    • EPHEXIN4
    • GEF16
    • NBR
    • Putative Neuroblastoma Protein
    • Rho guanine exchange factor (GEF) 16
    • Rho guanine nucleotide exchange factor (GEF) 16
    • Rho guanine nucleotide exchange factor 16
    see all
  • Function
    Guanyl-nucleotide exchange factor of the RHOG GTPase stimulating the exchange of RHOG-associated GDP for GTP. May play a role in chemotactic cell migration by mediating the activation of RAC1 by EPHA2. May also activate CDC42 and mediate activation of CDC42 by the viral protein HPV16 E6.
  • Sequence similarities
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
    Contains 1 SH3 domain.
  • Domain
    The PDZ-binding motif mediates interaction with TAX1BP3.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab162120 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162120 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162120.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up