Recombinant human RhoA protein (Active) (ab268932)
Key features and details
- Expression system: Escherichia coli
- Purity: > 85% SDS-PAGE
- Active: Yes
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human RhoA protein (Active)
See all RhoA proteins and peptides -
Biological activity
The specific activity of RhoA was 10.9 nmol/min/mg in GPTase-Glo assay.
-
Purity
> 85 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGC -
Molecular weight information
SDS-PAGE molecular weight: ~ 23kDa. -
Amino acids
1 to 190 -
Tags
His tag N-Terminus -
Additional sequence information
GenBank: NM_001664. Full-length mature protein lacking the signal peptide.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab268932 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.00
Preservative: 1.02% Imidazole
Constituents: 0.82% Sodium phosphate, 1.74% Sodium chloride, 0.002% PMSF, 0.004% DTT, 25% Glycerol (glycerin, glycerine)This product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- Aplysia ras related homolog 12
- ARH12
- ARHA
see all -
Function
Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. -
Sequence similarities
Belongs to the small GTPase superfamily. Rho family. -
Domain
The basic-rich region is essential for yopT recognition and cleavage. -
Post-translational
modificationsSubstrate for botulinum ADP-ribosyltransferase.
Cleaved by yopT protease when the cell is infected by some Yersinia pathogens. This removes the lipid attachment, and leads to its displacement from plasma membrane and to subsequent cytoskeleton cleavage.
AMPylation at Tyr-34 and Thr-37 are mediated by bacterial enzymes in case of infection by H.somnus and V.parahaemolyticus, respectively. AMPylation occurs in the effector region and leads to inactivation of the GTPase activity by preventing the interaction with downstream effectors, thereby inhibiting actin assembly in infected cells. It is unclear whether some human enzyme mediates AMPylation; FICD has such ability in vitro but additional experiments remain to be done to confirm results in vivo.
Ubiquitinated by the BCR(BACURD1) and BCR(BACURD2) E3 ubiquitin ligase complexes, leading to its degradation by the proteasome, thereby regulating the actin cytoskeleton and cell migration. -
Cellular localization
Cell membrane. Cytoplasm > cytoskeleton. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab268932 has not yet been referenced specifically in any publications.