Description

  • Product name

    Recombinant Human RHOBTB1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDADMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHV PTVWAIDQYRVCQEVLERSRDVVDEVSVSLRLWDTFGDHHKDRRFAYGRS DVVVLCFSIANPNSLNHVKSMWYPEIKHFCPRTPVILVGCQLDLRYADLE AVNRARRPLARPIKRGDILPPEKGREVAKELGLPYYETSVFDQFGIKDVF DNAIRAALISRRHLQFWKSHLKKVQKPLLQAPFLPPKAPPPVIKIPECPS MGTNEAACLLDNPLCADVLFILQDQEHIFAHRIYLATSSSKFYDLFLMEC EESPNGSEGACEKEKQSRDFQGRILSVDPEEEREEGPPRIPQADQWKSSN KSLVEALGLEAEGAVPETQTLTGWSKGFIGMHREMQVNPISKRMGPMTVV RMDASVQPGPFRTLLQFLYTGQLDEKEKDLVGLAQIAEVLEMFDLRMMVE NIMNKEAFMNQEITKAFHVRKANRIKECLSKGTFSDVTFKLDDGAISAHK PLLICSCEWMAAMFGGSFVESANSEVYLPNINKISMQAVLDYLYTKQLSP NLDLDPLELIALANRFCLPHLVALAEQHAVQELTKAATSGVGIDGEVLSY LELAQFHNAHQLAAWCLHHICTNYNSVCSKFRKEIKSKSADNQEYFERHR WPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWNSSPAVA
    • Amino acids

      1 to 696
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160698 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1700008H16Rik
    • 3110048G13Rik
    • AI173445
    • AI573858
    • AV350930
    • KIAA0740
    • MGC107538
    • MGC33059
    • MGC33841
    • OTTHUMP00000019662
    • OTTHUMP00000019663
    • RHBT1_HUMAN
    • Rho related BTB domain containing 1
    • Rho related BTB domain containing protein 1
    • Rho-related BTB domain-containing protein 1
    • Rhobtb1
    see all
  • Tissue specificity

    Ubiquitous, with highest levels in skeletal muscle, placenta, testis, stomach, and kidney, followed by uterus and adrenal gland. Expressed in a variety of fetal tissues.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rho family.
    Contains 2 BTB (POZ) domains.
  • Information by UniProt

Images

  • ab160698 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160698 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160698.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up