Description

  • Product name

    Recombinant Human RHOC protein
  • Purity

    > 90 % SDS-PAGE.
    ab98085 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAAIRKKLVIVGDGACGKTCLLIVFSKDQF PEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVI LMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRE LAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ VRKNKRRRGC
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      1 to 190
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Aplysia RAS-related homolog 9
    • ARH 9
    • ARH9
    • ARHC
    • H9
    • MGC1448
    • MGC61427
    • Oncogene RHO H9
    • Ras homolog gene family member C
    • RAS related homolog 9
    • RHO C
    • Rho cDNA clone 9
    • Rho related GTP binding protein RhoC
    • Rho-related GTP-binding protein RhoC
    • rhoC
    • RhoC GTPase
    • RHOC_HUMAN
    • RHOH 9
    • RHOH9
    • Small GTP binding protein RhoC
    see all
  • Function

    Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rho family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab98085

References

ab98085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up