Description

  • Product name

    Recombinant Human RhoGDI protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRK YKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQ SFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYG PRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKK DWKD
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      1 to 204

Specifications

Our Abpromise guarantee covers the use of ab132108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ARHGDIA
    • fa96g11
    • GDIA 1
    • GDIA1
    • GDIR1_HUMAN
    • MGC117248
    • NPHS8
    • Rho GDI
    • Rho GDI 1
    • Rho GDI alpha
    • Rho GDP dissociation inhibitor (GDI) alpha
    • Rho GDP dissociation inhibitor 1
    • Rho GDP dissociation inhibitor alpha
    • Rho GDP-dissociation inhibitor 1
    • Rho-GDI alpha
    • RHOGDI
    • RhoGDI 1
    • RhoGDI alpha
    • RhoGDI1
    • wu:fa96g11
    • zgc:55554
    • zgc:77681
    see all
  • Function

    Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
  • Sequence similarities

    Belongs to the Rho GDI family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132108, stained with Coomassie Blue.

References

ab132108 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up