Overview

  • Product name
    Recombinant Human Rhophilin-1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MILEERPDGAGAGEESPRLQGCDSLTQIQCGQLQSRRAQIHQQIDKELQM RTGAENLYRATSNNRVRETVALELSYVNSNLQLLKEELEELSGGVDPGRH GSEAVTVPMIPLGLKETKELDWSTPLKELISVHFGEDGASYEAEIRELEA LRQAMRTPSRNESGLELLTAYYNQLCFLDARFLTPARSLGLFFHWYDSLT GVPAQQRALAFEKGSVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAA GAFSLLRENFSHAPSPDMSAASLCALEQLMMAQAQECVFEGLSPPASMAP QDCLAQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTALVHVKAEY FRSLAHYHVAMALCDGSPATEGELPTHEQVFLQPPTSSKPRGPVLPQELE ERRQLGKAHLKRAILGQEEALRLHALCRVLREVDLLRAVISQTLQRSLAK YAELDREDDFCEAAEAPDIQPKTHQKPEARMPRLSQGKGPDIFHRLGPLS VFSAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLK EGDYIVSVNGQPCRWWRHAEVVTELKAAGEAGASLQVVSLLPSSRLPSLG DRRPVLLGPRGLLRSQREHGCKTPASTWASPRPLLNWSRKAQQGKTGGCP QPCAPVKPAPPSSLKHPGWP
    • Amino acids
      1 to 670
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as RHPN1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GTP Rho binding protein 1
    • GTP-Rho-binding protein 1
    • ODF5
    • Outer dense fiber of sperm tails 5
    • Rhophilin 1
    • Rhophilin-1
    • RHPN
    • Rhpn1
    • RHPN1_HUMAN
    see all
  • Function
    Has no enzymatic activity. May serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.
  • Sequence similarities
    Belongs to the RHPN family.
    Contains 1 BRO1 domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 REM (Hr1) repeat.
  • Domain
    The PDZ domain mediates interaction with ROPN1.
  • Information by UniProt

Images

  • ab165047 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up