Recombinant Human Ribonuclease 3/ECP protein (denatured) (ab137138)

Overview

  • Product name

    Recombinant Human Ribonuclease 3/ECP protein (denatured)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMRPPQFTRAQWFA IQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRC PHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCRYADRPGRRFYVVACD NRDPRDSPRYPVVPVHLDTTI
    • Molecular weight

      20 kDa including tags
    • Amino acids

      28 to 160
    • Tags

      His-DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab137138 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Ribonuclease 3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Cytotoxic ribonuclease
    • ECP
    • ECP_HUMAN
    • Eosinophil cationic protein
    • OTTHUMP00000164017
    • Ribonuclease 3
    • Ribonuclease, RNase A family, 3
    • RNase 3
    • RNASE3
    • RNS3
    see all
  • Function

    Cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. Possesses a wide variety of biological activities. Exhibits antibacterial activity.
  • Sequence similarities

    Belongs to the pancreatic ribonuclease family.
  • Cellular localization

    Cytoplasmic granule. Matrix of eosinophil's large specific granule.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab137138.

References

ab137138 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab137138.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up