Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSS STYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNC YKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDA SVEDST
    • Amino acids
      1 to 156
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HP-RNase
    • Pancreatic ribonuclease
    • Rib 1
    • RIB-1
    • Rib1
    • Ribonuclease 1
    • Ribonuclease A
    • Ribonuclease a family 1
    • Ribonuclease pancreatic
    • Ribonuclease RNase A family 1
    • Ribonuclease RNase A family 1 pancreatic
    • RNAS1_HUMAN
    • RNase 1
    • RNase A
    • RNase UpI-1
    • Rnase1
    • RNAseA
    see all
  • Function
    Endonuclease that catalyzes the cleavage of RNA on the 3' side of pyrimidine nucleotides. Acts on single stranded and double stranded RNA.
  • Tissue specificity
    Pancreas and other tissues and body fluids (indicating it may have other physiological functions besides its role in digestion).
  • Sequence similarities
    Belongs to the pancreatic ribonuclease family.
  • Post-translational
    modifications
    N-linked glycans are of complex type.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab159354 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159354 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up