Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEAPAAGLFLLLLLGTWAPAPGSASSEAPPLINEDVKRTVDLSSHLAKVT AEVVLAHLGGGSTSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEV RETKIKGKSGRFFTVKLPVALDPGAKISVIVETVYTHVLHPYPTQITQSE KRFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSEDLLDY GPFRDVPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDL KHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNV STSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYA LKMRFVDHVFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTY LDTFGRPVIVAYKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILF FTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRIGLYRHFDETV NRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTEGSDLCDRVSE MQKLDAQVKELVLRSAVEAERLVAGKLKKGTYVENEKLISGKRQELVTKI DHILDAL
    • Molecular weight

      93 kDa including tags
    • Amino acids

      1 to 607

Specifications

Our Abpromise guarantee covers the use of ab152663 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • D6Wsu137e
    • Dolichyl diphosphooligosaccharide protein glycosyltransferase 67 kDa subunit
    • Dolichyl diphosphooligosaccharide protein glycosyltransferase 67 kDa subunit precursor
    • Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit
    • Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
    • EC 2.4.1.119
    • Oligosaccharyltransferase 1 homolog
    • oligosaccharyltransferase complex subunit (non-catalytic)
    • OST1
    • RBPH1
    • Ribophorin I
    • Ribophorin-1
    • RPN-I
    • Rpn1
    • RPN1_HUMAN
    see all
  • Function

    Essential subunit of N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.
  • Tissue specificity

    Expressed in all tissues tested.
  • Sequence similarities

    Belongs to the OST1 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152663 stained with Coomassie Blue.

References

ab152663 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152663.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up