Overview

  • Product name
    Recombinant Human RIC3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPM MHHHQAHSDGQTPGARFQRSHLAEAFAKAKGSGGGAGGGGSGRGLMGQII PIYGFGIFLYILYILFKLSKGKTTAEDGKCYTAMPGNTHRKITSFELAQL QEKLKETEAAMEKLFNRVGPNGERAQTVTSDQEKRLLHQLREITRVMKEG KFIDRFSPEKEAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYP DPKELSAEEIAERMGMIEEEESDHLGWESLPTDPRAQEDNSVTSCDPKPE TCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGIST DKAYTGSMLRKRNPQGLE
    • Amino acids
      1 to 368
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AYST720
    • FLJ11608
    • PRO1385
    • Protein RIC-3
    • Resistance to inhibitors of cholinesterase 3 homolog
    • Resistant to inhibitor of cholinesterase 3
    • Ric3
    • RIC3 acetylcholine receptor chaperone
    • RIC3_HUMAN
    see all
  • Function
    Promotes functional expression of homomeric alpha-7 and alpha-8 nicotinic acetylcholine receptors at the cell surface. May also promote functional expression of homomeric serotoninergic 5-HT3 receptors, and of heteromeric acetylcholine receptors alpha-3/beta-2, alpha-3/beta-4, alpha-4/beta-2 and alpha-4/beta-4.
  • Tissue specificity
    Broadly expressed, with high levels in muscle, brain and heart. Over-expressed in brains from patients with bipolar disease or schizophrenia.
  • Sequence similarities
    Belongs to the ric-3 family.
  • Cellular localization
    Endoplasmic reticulum membrane and Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab164047 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up