Description

  • Product name

    Recombinant Human RIDA protein
  • Purity

    > 95 % SDS-PAGE.
    ab101632 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSSLIRRVISTAKAPGAIGPYSQAVLVDRT IYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAGCDFTNVVKTT VLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQG PLTTASL
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      1 to 137
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as HRSP12

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • 14.5 kDa translational inhibitor protein
    • 2-iminobutanoate/2-iminopropanoate deaminase
    • Heat responsive protein 12
    • Heat-responsive protein 12
    • Hrsp12
    • p14.5
    • Perchloric acid soluble protein
    • PSP
    • Reactive intermediate imine deaminase A homolog
    • Ribonuclease UK114
    • RIDA
    • Translational inhibitor p14.5
    • Translational inhibitor protein p14.5
    • UK114
    • UK114 antigen homolog
    • UK114_HUMAN
    see all
  • Function

    Endoribonuclease responsible for the inhibition of the translation by cleaving mRNA. Inhibits cell-free protein synthesis. Cleaves phosphodiester bonds only in single-stranded RNA.
  • Tissue specificity

    Hepatocytes and renal distal tubular epithelial cells. Only weak expression in other tissues.
  • Sequence similarities

    Belongs to the RutC family.
  • Developmental stage

    Up-regulated during cellular differentiation.
  • Cellular localization

    Cytoplasm. Nucleus. Mostly cytoplasmic but, in less differentiated cells occasionally nuclear.
  • Information by UniProt

Images

  • 15% SDS PAGE analysis of 3 µg ab101632.

References

ab101632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up