Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGP MEAATLFLKFLLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKL EEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEILQICSTKGMMA GAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDL EDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLEL ALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQI PVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQI LVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSG PLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELE QVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQ NREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYND ALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESV SRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGN PKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVA DEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEK EQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPV PDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKP KQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATG VQTLYSKWKDFHFEKIPFDPAEMSK
    • Molecular weight

      133 kDa including tags
    • Amino acids

      1 to 925

Specifications

Our Abpromise guarantee covers the use of ab132502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ddx58
    • DDX58_HUMAN
    • DEAD (Asp Glu Ala Asp) box polypeptide 58
    • DEAD (Asp Glu Ala Asp/His) box polypeptide
    • DEAD box protein 58
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide RIG1
    • DKFZp434J1111
    • DKFZp686N19181
    • FLJ13599
    • Probable ATP dependent RNA helicase DDX58
    • Probable ATP-dependent RNA helicase DDX58
    • Retinoic acid inducible gene 1 protein
    • Retinoic acid-inducible gene 1 protein
    • Retinoic acid-inducible gene I protein
    • RIG I
    • Rig-1
    • RIG-I
    • RIG1
    • rigi
    • RLR 1
    • RNA helicase
    • RNA helicase RIG I
    • SGMRT2
    see all
  • Function

    Involved in innate immune defense against viruses. Upon interaction with intracellular dsRNA produced during viral replication, triggers a transduction cascade involving MAVS/IPS1, which results in the activation of NF-kappa-B, IRF3 and IRF7 and the induction of the expression of antiviral cytokines such as IFN-beta and RANTES (CCL5). Detects dsRNA produced from non-self dsDNA by RNA polymerase III, such as Epstein-Barr virus-encoded RNAs (EBERs). Essential for the production of interferons in response to RNA viruses including paramyxoviruses, influenza viruses, Japanese encephalitis virus and HCV.
  • Tissue specificity

    Present in vascular smooth cells (at protein level).
  • Sequence similarities

    Belongs to the helicase family.
    Contains 2 CARD domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Domain

    The repressor domain controls homomultimerization and interaction with MAVS.
    The helicase domain is responsible for dsRNA recognition.
    The 2 CARD domains are responsible for interaction with and signaling through MAVS.
    The second CARD domain is the primary site for 'Lys-63'-linked ubiquitination.
  • Post-translational
    modifications

    Isgylated. Conjugated to ubiquitin-like protein ISG15 upon IFN-beta stimulation.
    Ubiquitinated. Undergoes 'Lys-63'-linked ubiquitination. Lys-172 is the critical site for TRIM25-mediated ubiquitination, for MAVS binding and to induce anti-viral signal transduction. Lys-154, Lys-164 and Lys-172 are critical sites for RNF135-mediated ubiquitination. Deubiquitinated by CYLD, a protease that selectively cleaves 'Lys-63'-linked ubiquitin chains.
  • Cellular localization

    Cytoplasm. Colocalized with TRIM25 at cytoplasmic perinuclear bodies.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132502 stained with Coomassie Blue.

References

ab132502 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up