Description

  • Product name

    Recombinant Human RIL protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQ AINGESTELMTHLEAQNRIKGCHDHLTLSVSRPEGRSWPSAPDDSKAQAH RIHIDPEIQDGSPTTSRRPSGTGTGPEDGRPSLGSPYGQPPRFPVPHNGS SEATLPAQMSTLHVSPPPSADPARGLPRSRDCRVDLGSEVYRMLREPAEP VAAEPKQSGSFRYLQGMLEVGEGGAPSSRHGTSSTIPSASCAVTAA
    • Predicted molecular weight

      53 kDa including tags
    • Amino acids

      1 to 246

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132015 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Enigma homolog
    • LIM domain protein
    • LIM domain protein RIL
    • LIM protein RIL
    • PDLI4_HUMAN
    • PDLIM 4
    • PDLIM4
    • PDZ and LIM domain 4
    • PDZ and LIM domain protein 4
    • Reversion induced LIM protein
    • Reversion-induced LIM protein
    see all
  • Tissue specificity

    Isoform 2 is found in brain.
  • Sequence similarities

    Contains 1 LIM zinc-binding domain.
    Contains 1 PDZ (DHR) domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residue(s). Can be dephosphorylated by PTPN13.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132015 at approximately 52.8 kDa.

References

ab132015 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132015.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up