Recombinant Human RING finger protein unkempt like (ab163860)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KQLQEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGV IFQLRAKQCVACRERAHGAVLRPCQHHILCEPCAATAPECPYCKGQPLQW
    • Amino acids
      130 to 229
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C16orf28
    • FLJ12623
    • FLJ23360
    • KIAA0734
    • MGC5179
    • Putative E3 ubiquitin-protein ligase UNKL
    • RING finger protein unkempt-like
    • Unkempt homolog (Drosophila) like
    • Unkempt like
    • Unkempt like protein
    • Unkl
    • UNKL_HUMAN
    • ZC3H5L
    • ZC3HDC5L
    • Zinc finger CCCH domain-containing protein 5-like
    see all
  • Function
    May participate in a protein complex showing an E3 ligase activity regulated by RAC1. Ubiquitination is directed towards itself and possibly other substrates, such as SMARCD2/BAF60b. Intrinsic E3 ligase activity has not been proven.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the unkempt family.
    Contains 4 C3H1-type zinc fingers.
    Contains 1 RING-type zinc finger.
  • Domain
    Although this protein contains a RING domain, intrinsic E3 ligase activity has not been proven (PubMed:20148946).
  • Post-translational
    modifications
    Isoform 4 is ubiquitinated in the C-terminal. Ubiquitination is enhanced by activated RAC1. The presence of the RING finger domain is not essential for ubiquitination to occur.
  • Cellular localization
    Cytoplasm. Nucleus. Isoform 4 is primarily localized in the cytoplasm but has the ability to shuttle between the nucleus and the cytoplasm.
  • Information by UniProt

Images

  • ab163860 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up