Description

  • Product name

    Recombinant Human RINGO C protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLWAIPELGSPCPISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGF LRFRQHQEVQAFLSLLEDSFVQEFLSKDPCFQISDKYLLAMVLVYFQRAH LKLSEYTHSSLFLALYLANDMEEDLEGPKCEIFPWALGKDWCLRVGKFLH QRDKLWARMGFRAVVSRQCCEEVMAKEPFHWAWTRDRRPHHGGVQRVCPQ VPVRLPRGPGLSPPHCSPCGLPQHCSSHLLKPVSSKCPSLTSECHRPPSQ NYLSRVKNAWGGDFLIVLPPQMQLEPGTYSLRIFPKPPARPGH
    • Amino acids

      1 to 293
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Speedy protein C. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hSpy/Ringo C
    • Rapid inducer of G2/M progression in oocytes C
    • Rapid inducer of G2/M progression in oocytes, Xenopus, homolog of, C
    • RINGO C
    • Ringo2
    • SPDYC
    • SPDYC_HUMAN
    • speedy C
    • speedy homolog C
    • Speedy protein C
    • Speedy, Xenopus, homolog of, C
    see all
  • Function

    Promotes progression through the cell cycle via binding and activation of CDK1 and CDK2.
  • Tissue specificity

    Expressed in a variety of tissues including bone marrow, kidney, small intestine, liver, placenta and testis.
  • Sequence similarities

    Belongs to the Speedy/Ringo family.
  • Domain

    The C-terminus is required for CDK2-activation, but not CDK2-binding.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab166404 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166404 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up