Description

  • Product name

    Recombinant Human RIO2 protein (Tagged)
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGKVNVAKLRYMSRDDFRVLTAVEMGMKNHEIVPGSLIASIASLKHGGCN KVLRELVKHKLIAWERTKTVQGYRLTNAGYDYLALKTLSSRQVVESVGNQ MGVGKESDIYIVANEEGQQFALKLHRLGRTSFRNLKNKRDYHKYRHNVSW LYLSRLSAMKEFAYMKALYERKFPVPKPIDYNRHAVVMELINGYPLCQIH HVEDPASVYDEAMELIVKLANHGLIHGDFNEFNLILDESDHITMIDFPQM VSTSHPNAEWYFDRDVKCIKDFFMKRFSYESELFPTFKDIRREDTLDVEV SASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYGS ENESERNCLEESEGCYCRSSGDPEQIKEDSLSEESADARSFEMTEFNQAL EEIKGQVVENNSVTEFSEEKNRTENYNRQDGQRVQGGVPAGSDEYEDECP HLIALSSLNREFRPFRDEENVGAMNQYRTRTLSITSSGSAVSCSTIPPEL AKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNIKSSLEAASFW GE
    • Amino acids

      1 to 552
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously known as RIOK2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ11159
    • OTTHUMP00000158911
    • OTTHUMP00000222868
    • RIO kinase 2
    • RIO kinase 2 (yeast)
    • RIO2
    • RIOK2
    • RIOK2_HUMAN
    • Serine/threonine protein kinase RIO2
    • Serine/threonine-protein kinase rio2
    see all
  • Sequence similarities

    Belongs to the protein kinase superfamily. RIO-type Ser/Thr kinase family.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab163216 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163216 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up