Description

  • Product name

    Recombinant Human RIPK4 protein
  • Purity

    > 75 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RTFDAGEFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDDRERM ELLEEAKKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLP WDLRFRIIHETAVGMNFLHCMAPPLLHLDLKPANILLDAHYHVKISDFGL AKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIW GVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQR CWQGDPRVRPTFQGNGLNGELIRQVLAALLPVTGRWRSPGEGFRLESEVI IRVTCPLSSPQEITSETEDLCEKPDDEVKETAHDLDVKSPPEPRSEVVPA RLKRASAPTFDNDYSLSELLSQLDSGVSQAVEGPEELSRSSSESKLPSSG SGKRLSGVSSVD
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      15 to 426
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      BC110618

Specifications

Our Abpromise guarantee covers the use of ab203541 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.0038% DTT, 0.0017% PMSF, 25% Glycerol

General Info

  • Alternative names

    • ANKK 2
    • ANKK2
    • ANKRD 3
    • ANKRD3
    • Ankyrin repeat domain 3
    • ankyrin repeat domain containing protein 3
    • Ankyrin repeat domain protein 3
    • DIK
    • MGC129992
    • MGC129993
    • PKC delta interacting protein kinase
    • PKK
    • protein kinase C-associated kinase
    • Receptor interacting serine threonine kinase 4
    • Receptor interacting serine/threonine protein kinase 4
    • RIP 4
    • RIP4
    • RIPK 4
    • Serine/threonine protein kinase ANKRD3
    see all
  • Relevance

    RIPK4 (receptor-interacting serine-threonine kinase 4) is a serine/threonine protein kinase which undergoes autophosphorylation. It can activate NFkappaB and is required for keratinocyte differentiation. It interacts with protein kinase C-delta (PRKCD).
  • Cellular localization

    Cytoplasm. Membrane; Peripheral membrane protein.

Images

  • Densitometric analysis of the purity of ab203541.

References

ab203541 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203541.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up