Overview

  • Product name

    Recombinant Human RIT1/RIT protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      RVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRY YIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDS
    • Amino acids

      120 to 217
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159352 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as RIT1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GTP binding protein Roc1
    • GTP-binding protein Rit1
    • NS8
    • Ras like protein expressed in many tissues
    • Ras like without CAAX 1
    • Ras-like protein expressed in many tissues
    • Ras-like without CAAX protein 1
    • RIBB
    • Ric like expressed in many tissues
    • Ric-like protein without CAAX motif 1
    • RIT
    • RIT1
    • RIT1_HUMAN
    • ROC1
    see all
  • Function

    Plays a crucial role in coupling NGF stimulation to the activation of both EPHB2 and MAPK14 signaling pathways and in NGF-dependent neuronal differentiation.
  • Tissue specificity

    Expressed in many tissues.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Ras family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab159352 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159352 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159352.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up