Recombinant Human RIZ1 protein (Tagged) (ab176927)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPIL KGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRY VNWACSGEEQNLFPLEINR AIYYKTLKPIAPGEELLVWYNGEDNPEIA AAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTS A
    • Molecular weight
      50 kDa including tags
    • Amino acids
      2 to 200
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab176927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

General Info

  • Alternative names
    • GATA-3-binding protein G3B
    • HUMHOXY1
    • KMT8
    • Lysine N-methyltransferase 8
    • MTB-ZF
    • MTE-binding protein
    • PR domain containing 2, with ZNF domain
    • PR domain zinc finger protein 2
    • PR domain-containing protein 2
    • PRDM2
    • PRDM2_HUMAN
    • Retinoblastoma protein binding zinc finger protein
    • Retinoblastoma protein-interacting zinc finger protein
    • Retinoblastoma protein-interacting zinc-finger protein
    • RIZ
    • RIZ1
    • RIZ2
    • Zinc finger DNA binding protein
    • Zinc finger protein RIZ
    see all
  • Function
    S-adenosyl-L-methionine-dependent histone methyltransferase that specifically methylates 'Lys-9' of histone H3. May function as a DNA-binding transcription factor. Binds to the macrophage-specific TPA-responsive element (MTE) of the HMOX1 (heme oxygenase 1) gene and may act as a transcriptional activator of this gene.
  • Tissue specificity
    Highly expressed in retinoblastoma cell lines and in brain tumors. Also expressed in a number of other cell lines and in brain, heart, skeletal muscle, liver and spleen. Isoform 1 is expressed in testis at much higher level than isoform 3.
  • Sequence similarities
    Contains 8 C2H2-type zinc fingers.
    Contains 1 SET domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • SDS PAGE analysis of ab176927

    Lane 1: ab176927 (5 μg)

    Lane 2: ab176927 (2 μg)

References

ab176927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176927.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up