Description

  • Product name

    Recombinant Human RN-tre protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNSDQDVALKLAQERAEIVAKYDRGREGAEIEPWEDADYLVYKVTDRFGF LHEEELPDHNVAVERQKHLEIERTTKWLKMLKGWEKYKNTEKFHRRIYKG IPLQLRGEVWALLLEIPKMKEETRDLYSKLKHRARGCSPDIRQIDLDVNR TFRDHIMFRDRYGVKQQSLFHVLAAYSIYNTEVGYCQGMSQITALLLMYM NEEDAFWALVKLFSGPKHAMHGFFVQGFPKLLRFQEHHEKILNKFLSKLK QHLDSQEIYTSFYTMKWFFQCFLDRTPFTLNLRIWDIYIFEGERVLTAMS YTILKLHKKHLMKLSMEELVEFFQETLAKDFFFEDDFVIEQLQISMTELK RAKLDLPEPGKEDEYPKKPLGQLPPELQSWGVHHLSNGQRSVGRPSPLAS GRRESGAPHRRHEHSPHPQSRTGTPERAQPPRRKSVEEESKKLKDEADFQ RKLPSGPQDSSRQYNHAAANQNSNATSNIRKEFVPKWNKPSDVSATERTA KYTMEGKGRAAHPALAVTVPGPAEVRVSNVRPKMKALDAEDGKRGSTASQ YDNVPGPELDSGASVEEALERAYSQSPRHALYPPSPRKHAEPSSSPSKVS NKFTFKVQPPSHARYPSQLDGEARGLAHPPSYSNPPVYHGNSPKHFPTAN SSFASPQFSPGTQLNPSRRPHGSTLSVSASPEKSYSRPSPLVLPSSRIEV LPVDTGAGGYSGNSGSPKNGKLIIPPVDYLPDNRTWSEVSYTYRPETQGQ SWTRDASRGNLPKYSAFQLAPFQDHGLPAVSVDSPVRYKASPAAEDASPS GYPYSGPPPPAYHYRNRDGLSIQESVLL
    • Amino acids

      1 to 828
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160623 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as USP6NL.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • KIAA0019
    • Related to the N terminus of tre
    • Related to the N-terminus of tre
    • RN tre
    • RN-tre
    • RNTRE
    • TRE2NL
    • US6NL_HUMAN
    • USP6 N terminal like
    • USP6 N terminal like protein
    • USP6 N-terminal-like protein
    • USP6NL
    see all
  • Function

    Acts as a GTPase-activating protein for RAB5A and RAB43. Involved in receptor trafficking. In complex with EPS8 inhibits internalization of EGFR. Involved in retrograde transport from the endocytic pathway to the Golgi apparatus. Involved in the transport of Shiga toxin from early and recycling endosomes to the trans-Golgi network. Required for structural integrity of the Golgi complex.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Contains 1 Rab-GAP TBC domain.
  • Cellular localization

    Golgi apparatus. Cytoplasmic vesicle.
  • Information by UniProt

Images

  • ab160623 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160623 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160623.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up