Recombinant Human RNA Helicase A protein (ab114300)
Key features and details
- Expression system: Wheat germ
- Suitable for: WB, ELISA, SDS-PAGE
Description
-
Product name
Recombinant Human RNA Helicase A protein
See all RNA Helicase A proteins and peptides -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGDVKNFLYAWCGKRKMTPTYEIRAVGNKNRQKFMCEVQVEGYNYTGMGN STNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP -
Predicted molecular weight
36 kDa including tags -
Amino acids
1 to 90
-
Specifications
Our Abpromise guarantee covers the use of ab114300 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- ATP dependent RNA helicase A
- ATP-dependent RNA helicase A
- DDX 9
see all -
Function
Unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure may subsequently influence interactions with proteins or other nucleic acids. Functions as a transcriptional activator. Component of the CRD-mediated complex that promotes MYC mRNA stability. -
Sequence similarities
Belongs to the DEAD box helicase family. DEAH subfamily.
Contains 2 DRBM (double-stranded RNA-binding) domains.
Contains 1 helicase ATP-binding domain.
Contains 1 helicase C-terminal domain. -
Domain
The MTAD domain mediates interaction with the RNA polymerase II holoenzyme. The NTD domain is necessary and sufficient for nucleo-cytoplasmic shuttling and interaction with HRMT1L2 and SMN1. -
Post-translational
modificationsMethylated. HRMT1L2 mediated methylation of undefined Arg residues in the NTD is required for nuclear localization.
May be phosphorylated by PRKDC/XRCC7. Phosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Nucleus > nucleolus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Can shuttle between nucleus and cytoplasm. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab114300 has not yet been referenced specifically in any publications.