Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPV DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE GDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
    • Amino acids
      1 to 150
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159157 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • and III 17.1 kDa polypeptide
    • and III subunit ABC3
    • DNA directed RNA polymerases I, II, and III 17.1 kDa polypeptide
    • DNA directed RNA polymerases I, II, and III subunit RPABC3
    • DNA-directed RNA polymerase II subunit H
    • DNA-directed RNA polymerases I
    • DNA-directed RNA polymerases I, II, and III subunit RPABC3
    • hRPB8
    • HsRPB8
    • II
    • POLR2H
    • Polymerase (RNA) II (DNA directed) polypeptide H
    • RNA polymerases I
    • RNA polymerases I, II, and III subunit ABC3
    • RPAB3_HUMAN
    • RPABC3
    • RPB17
    • RPB8
    • RPB8 homolog
    see all
  • Function
    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively.
  • Sequence similarities
    Belongs to the eukaryotic RPB8 RNA polymerase subunit family.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab159157 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:
  • Liu H  et al. Isolation, culture and induced differentiation of rabbit mesenchymal stem cells into osteoblasts. Exp Ther Med 15:3715-3724 (2018). Read more (PubMed: 29581732) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159157.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up