Recombinant Human RNA polymerase II RBP8 protein (ab159157)
- Datasheet
- References (1)
- Protocols
Overview
-
Product nameRecombinant Human RNA polymerase II RBP8 protein
See all RNA polymerase II RBP8 proteins and peptides -
Protein lengthFull length protein
Description
-
NatureRecombinant
-
SourceWheat germ
-
Amino Acid Sequence
-
SpeciesHuman
-
SequenceMAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPV DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE GDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
-
Amino acids1 to 150
-
Tagsproprietary tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab159157 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
FormLiquid
-
Additional notesProtein concentration is above or equal to 0.05 mg/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- and III 17.1 kDa polypeptide
- and III subunit ABC3
- DNA directed RNA polymerases I, II, and III 17.1 kDa polypeptide
see all -
FunctionDNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively.
-
Sequence similaritiesBelongs to the eukaryotic RPB8 RNA polymerase subunit family.
-
Cellular localizationNucleus > nucleolus.
- Information by UniProt
Images
-
SDS-PAGE - Recombinant Human RNA polymerase II RBP8 protein (ab159157)ab159157 on a 12.5% SDS-PAGE stained with Coomassie Blue.
Datasheets and documents
References
This product has been referenced in:
- Liu H et al. Isolation, culture and induced differentiation of rabbit mesenchymal stem cells into osteoblasts. Exp Ther Med 15:3715-3724 (2018). Read more (PubMed: 29581732) »
