Description

  • Product name

    Recombinant Human RNA polymerase II RPB11 protein
  • Purity

    > 90 % SDS-PAGE.
    ab134594 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMNAPPAFESFLLFEGEKKITINKDTKV PNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQT TPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      1 to 117
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.08% DTT, 0.32% Tris HCl, 0.06% EDTA, 40% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • DNA directed RNA polymerase II subunit RPB11 a
    • DNA-directed RNA polymerase II 13.3 kDa polypeptide
    • DNA-directed RNA polymerase II subunit J 1
    • DNA-directed RNA polymerase II subunit J-1
    • DNA-directed RNA polymerase II subunit RPB11-a
    • hRPB 14
    • hRPB14
    • POLR 2J1
    • POLR2J
    • POLR2J1
    • polymerase (RNA) II (DNA directed) polypeptide J 13.3kDa
    • RNA polymerase II 13.3 kDa subunit
    • RNA polymerase II subunit B11 a
    • RNA polymerase II subunit B11-a
    • RPB 11
    • RPB 11A
    • RPB 11m
    • RPB11
    • RPB11_HUMAN
    • RPB11a
    • RPB11m
    • Rpo2-4
    see all
  • Function

    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft.
  • Tissue specificity

    Ubiquitously expressed. High expression was found in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the archaeal rpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134594

References

ab134594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up