Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAPARAGFCPLLLLLLLGLWVAEIPVSAKPKGMTSSQWFKIQHMQPSPQA CNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQS HGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPV HLDRVL
    • Amino acids

      1 to 156
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as Ribonuclease 7.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EC 3.1.27.-
    • MGC133220
    • Ribonuclease 7
    • ribonuclease, RNase A family, 7
    • RNAS7_HUMAN
    • RNase 7
    • RNASE7
    • SAP 2
    • SAP-2
    • Skin derived antimicrobial protein 2
    • Skin-derived antimicrobial protein 2
    see all
  • Function

    Exhibits a potent RNase activity. Has broad-spectrum antimicrobial activity against many pathogenic microorganisms and remarkably potent activity (lethal dose of 90% < 30 nM) against a vancomycin resistant Enterococcus faecium.
  • Tissue specificity

    Expressed in various epithelial tissues including skin, respiratory tract, genito-urinary tract and, at a low level, in the gut. Expressed in liver, kidney, skeletal muscle and heart.
  • Sequence similarities

    Belongs to the pancreatic ribonuclease family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab164629 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164629 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up