Overview

  • Product name
    Recombinant Human RND2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MWDTSGSSYYDNVRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEF CPNAKVVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSY VECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRP DRGNEGEIHKDRAKSCNLM
    • Amino acids
      59 to 227
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARHN
    • CTD-3199J23.4
    • GTP-binding protein Rho7
    • ras homolog gene family, member N
    • Rho 7
    • Rho family GTPase 2
    • Rho N
    • Rho related GTP-binding protein RhoN
    • Rho-related GTP-binding protein Rho7
    • Rho-related GTP-binding protein RhoN
    • Rho7
    • RhoN
    • Rnd 2
    • Rnd2
    • RND2_HUMAN
    see all
  • Function
    May be specifically involved in neuronal and hepatic functions. Is a C3 toxin-insensitive member of the Rho subfamily.
  • Tissue specificity
    Highly expressed in testis.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rho family.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle > acrosome membrane. Colocalizes with RACGAP1 in Golgi-derived proacrosomal vesicles and the acrosome.
  • Information by UniProt

Images

  • ab159951 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up