Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MPLSSPNAAATASDMDKNSGSNSSSASSGSSKGQQPPRSASAGPAGESKP KSDGKNSSGSKRYNRKRELSYPKNESFNNQSRRSSSQKSKTFNKMPPQRG GGSSKLFSSSFNGGRRDEVAEAQRAEFSPAQFSGPKKINLNHLLNFTFEP RGQTGHFEGSGHGSWGKRNKWGHKPFNKELFLQANCQFVVSEDQDYTAHF ADPDTLVNWDFVEQVRICSHEVPSCPICLYPPTAAKITRCGHIFCWACIL HYLSLSEKTWSKCPICYSSVHKKDLKSVVATESHQYVVGDTITMQLMKRE KGVLVALPKSKWMNVDHPIHLGDEQHSQYSKLLLASKEQVLHRVVLEEKV ALEQQLAEEKHTPESCFIEAAIQELKTREEALSGLAGSRREVTGVVAALE QLVLMAPLAKESVFQPRKGVLEYLSAFDEETTEVCSLDTPSRPLALPLVE EEEAVSEPEPEGLPEACDDLELADDNLKEGTICTESSQQEPITKSGFTRL SSSPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAG YSMSEDVRQRHRYLSHLPLTCEFSICELALQPPVVSKETLEMFSDDIEKR KRQRQKKAREERRRERRIEIEENKKQGKYPEVHIPLENLQQFPAFNSYTC SSDSALGPTSTEGHGALSISPLSRSPGSHADFLLTPLSPTASQGSPSFCV GSLEEDSPFPSFAQMLRVGKAKADVWPKTAPKKDENSLVPPAPVDSDGES DNSDRVPVPSFQNSFSQAIEAAFMKLDTPATSDPLSEEKGGKKRKKQKQK LLFSTSVVHTK
    • Amino acids

      1 to 811
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AA675014
    • KIAA0262
    • MGC126758
    • MGC126764
    • RIE2
    • Ring finger protein 10
    • Sid 2705
    see all
  • Relevance

    The RNF10 protein contains a ring finger motif, which is known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. EST data suggests the existence of multiple alternatively spliced transcript variants, however, their full length nature is not known.
  • Cellular localization

    Cytoplasmic and Nuclear

Images

  • ab160715 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up