Overview

  • Product name
    Recombinant Human RNF111 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFP AGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQA GPSYVQNC
    • Amino acids
      1 to 108
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162838 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARK
    • Arkadia
    • DKFZp313E0731
    • DKFZp686H1966
    • DKFZp761D081
    • E3 ubiquitin protein ligase Arkadia
    • E3 ubiquitin-protein ligase Arkadia
    • FLJ38008
    • RING finger protein 111
    • RN111_HUMAN
    • RNF 111
    • RNF111
    see all
  • Function
    Acts in the NODAL pathway of mesoderm patterning during embryonic development. Acts downstream AXIN1 as an E3 ubiquitin-protein ligase which promotes the ubiquitination of inhibitory SMADs such as SMAD7, induces their proteasomal degradation and thereby enhances the transcriptional activity of TGF-beta and BMP. Activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation.
  • Tissue specificity
    Broadly expressed.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
  • Cellular localization
    Nucleus. Cytoplasm. Upon TGF-beta treatment, translocates from nucleus to cytosol.
  • Information by UniProt

Images

  • ab162838 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162838 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up