Overview

  • Product name

    Recombinant Human RNF115 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVT DDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDN RANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPAIEGILQHIFA GFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTG PPPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFF HSSCIVPWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHD RWTF
    • Amino acids

      1 to 304
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as ZNF364.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BCA2
    • Breast cancer associated gene 2
    • CL469780
    • E3 ubiquitin-protein ligase RNF115
    • Rabring 7
    • RING finger protein 115
    • RN115_HUMAN
    • RNF115
    • Zinc finger protein 364
    • ZNF364
    see all
  • Function

    Acts as an E2-dependent E3 ubiquitin-protein ligase. May be involved in endocytic trafficking.
  • Tissue specificity

    Expressed at extremely low levels in normal breast, prostate, lung, colon. Higher levels of expression are detected in heart, skeletal muscle, testis as well as in breast and prostate cancer cells.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications

    RING-type zinc finger-dependent and E2-dependent autoubiquitination.
  • Cellular localization

    Cytoplasm > cytosol. The GTP-bound form of RAB7A recruits RNF115 from the cytosol onto late endosomes/lysosomes.
  • Information by UniProt

Images

  • ab162124 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up