Overview

  • Product name
    Recombinant Human RNF123 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAV FQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKGANTSTTSSAA
    • Amino acids
      1216 to 1314
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686C2222
    • E3 ubiquitin protein ligase RNF123
    • E3 ubiquitin-protein ligase RNF123
    • FLJ12565
    • FP1477
    • Kip1 ubiquitination promoting complex protein 1
    • Kip1 ubiquitination-promoting complex protein 1
    • KPC 1
    • KPC1
    • MGC163504
    • RING finger protein 123
    • RN123_HUMAN
    • RNF 123
    • Rnf123
    • Ubiquitin ligase
    see all
  • Function
    Catalytic subunit of the KPC complex that acts as E3 ubiquitin-protein ligase. Required for poly-ubiquitination and proteasome-mediated degradation of CDKN1B during G1 phase of the cell cycle.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Ubiquitinated, leading to its degradation. Deubiquitinated by USP19, thereby stimulating CDKN1B ubiquitin-dependent degradation.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab163748 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163748 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up