Description

  • Product name

    Recombinant Human RNF128/GRAIL protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGPPPGAGVSCRGGCGFSRLLAWCFLLALSPQAPGSRGAEAVWTAYLNVS WRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHT NFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPG TRNEVIPMSHPGAVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHG PWVNHYSIFFVSVSFFIITAATVGYFIFYSARRLRNARAQSRKQRQLKAD AKKAIGRLQLRTLKQGDKEIGPDGDSCAVCIELYKPNDLVRILTCNHIFH KTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSA SSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAV DVIPHVDNPTFEEDETPNQETAVREIKS
    • Amino acids

      1 to 428
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as RNF128. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • E3 ubiquitin protein ligase RNF128
    • E3 ubiquitin-protein ligase RNF128
    • FLJ23516
    • Gene related to anergy in lymphocytes protein
    • GRAIL
    • RING finger protein 128
    • RN128_HUMAN
    • RNF128
    see all
  • Function

    E3 ubiquitin-protein ligase that catalyzes polyubiquitin chains. Functions as an inhibitor of cytokine gene transcription. Inhibits IL2 and IL4 transcription and this activity is likely to be mediated by E3 ligase activity. Plays an important role in the induction of the anergic phenotype. Functions in the patterning of the dorsal ectoderm; sensitizes ectoderm to respond to neural-inducing signals.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 PA (protease associated) domain.
    Contains 1 RING-type zinc finger.
  • Domain

    Binding to E2 ubiquitin-conjugating enzyme requires an intact RING finger domain.
  • Post-translational
    modifications

    Auto-ubiquitinated. Controls the development of T cell clonal anergy by ubiquitination.
  • Cellular localization

    Endomembrane system. Cytoplasm > perinuclear region. Localized in an asymmetric perinuclear punctate manner. Localizes to the internal pool of the transferrin recycling endosomal pathway. Partially colocalized with the endoplasmic reticulum resident HSPA5, with Golgi resident STX5, and with the late endosomal GTPase RAB7.
  • Information by UniProt

Images

  • ab164040 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164040 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up