Overview

  • Product name

    Recombinant Human RNF130 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTHPGTGDIIAVMITELRGKDILSYLEKNISVQMTIAVGTRMPPKNFSRG SLVFVSISFIVLMIISSAWLIFYFIQKIRYTNARDRNQRRLGDAAKKAIS KLTTRTVKKGDKETDPDFDHCAVCIESYKQNDVVRILPCKHVFHKSCVDP WLSEHCTCPMCKLNILKALGIVPNLPCTDNVAFDMERLTRTQAVNRRSAL GDLAGDNSLGLEPLRTSGISPLPQDGELTPRTGEINIAVTKEWFIIASFG LLSALTLCYMIIRATASLNANEVEWF
    • Molecular weight

      57 kDa including tags
    • Amino acids

      144 to 419

Specifications

Our Abpromise guarantee covers the use of ab132533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2510042A13Rik
    • G1 related zinc finger protein
    • G1rp
    • G1RZFP
    • GOLIATH
    • GP
    • MGC117241
    • MGC138647
    • MGC99542
    • R goliath
    • RING finger protein 130
    see all
  • Relevance

    RNF130 contains a RING finger motif and is similar to g1, a Drosophila zinc-finger protein that is expressed in mesoderm and involved in embryonic development. The expression of the mouse counterpart was found to be upregulated in myeloblastic cells following IL3 deprivation, suggesting that this gene may regulate growth factor withdrawal-induced apoptosis of myeloid precursor cells.
  • Cellular localization

    Membrane; single-pass type I membrane protein

Images

  • 12.5% SDS-PAGE analysis of ab132533 stained with Coomassie Blue.

References

ab132533 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up