Overview

  • Product name
    Recombinant Human RNF135 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWG ARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAH CPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVR SLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGL LSGPSIQPLT
    • Amino acids
      1 to 210
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164552 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase RNF135
    • L13
    • MGC13061
    • MMFD
    • REUL
    • RIG-I E3 ubiquitin ligase
    • RING finger protein 135
    • Riplet
    • RN135_HUMAN
    • Rnf135
    see all
  • Function
    Acts as an E2-dependent E3 ubiquitin-protein ligase, involved in innate immune defense against viruses. Ubiquitinates DDX58 and is required for full activation of the DDX58 signaling resulting in interferon beta production.
  • Tissue specificity
    Expressed in skeletal muscle, spleen, kidney, placenta, prostate, stomach, thyroid and tongue. Also weakly expressed in heart, thymus, liver and lung.
  • Pathway
    Protein modification; protein ubiquitination.
  • Involvement in disease
    Defects in RNF135 are the cause of macrocephaly macrosomia facial dysmorphism syndrome (MMFD) [MIM:614192]. MMFD is an autosomal dominant disorder characterized by the association of macrothrombocytopathy and progressive sensorineural hearing loss without renal dysfunction.
  • Sequence similarities
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab164552 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164552 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164552.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up