Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEDLSAATSYTEDDFYCPVCQEVLKTPVRTTACQHVFCRKCFLTAMRES GAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYRMRH HYKSCKKYQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQENTS SSGHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDP SQITRNFVSHLNQRHQFDYGEFVNLQLDEETQYQTAVEESFQVNI
    • Amino acids
      1 to 245
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162555 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin protein ligase RNF138
    • E3 ubiquitin-protein ligase RNF138
    • hNARF
    • HSD 4
    • HSD4
    • MGC8758
    • NARF
    • Nemo like kinase associated RING finger protein
    • Nemo-like kinase-associated RING finger protein
    • NLK associated RING finger protein
    • NLK-associated RING finger protein
    • RING finger protein 138
    • ring finger protein 138, E3 ubiquitin protein ligase
    • RN138_HUMAN
    • Rnf138
    • STRIN
    see all
  • Function
    E3 ubiquitin-protein ligase. Together with NLK, involved in the ubiquitination and degradation of TCF/LEF. Also exhibits auto-ubiquitination activity in combination with UBE2K. May act as a negative regulator in the Wnt/beta-catenin-mediated signaling pathway.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
  • Domain
    The RING-type zinc finger domain mediates binding to an E2 ubiquitin-conjugating enzyme.
  • Post-translational
    modifications
    Auto-ubiquitinated.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • ab162555 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162555 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162555.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up