Overview

  • Product name
    Recombinant Human RNF144A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTTARYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQH VELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFER EVLFDPCRTWCPASTCQAVCQLRDVGLQTPQPVQCKACRMEFCSTCKASW HPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQ MMCKNCKHAFCWYCPESLDDDFLLIHCDKGPCRNKLGHSRASVIWHRTQV VGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT
    • Amino acids
      1 to 292
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160650 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as RNF144. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA0161
    • Probable E3 ubiquitin protein ligase RNF144A
    • Probable E3 ubiquitin-protein ligase RNF144A
    • R144A_HUMAN
    • Ring finger protein 144
    • RING finger protein 144A
    • RNF 144
    • RNF 144A
    • RNF144
    • rnf144a
    • UBCE7IP4
    • UbcM4 interacting protein 4
    • UbcM4-interacting protein 4
    • Ubiquitin conjugating enzyme 7 interacting protein 4
    • Ubiquitin-conjugating enzyme 7-interacting protein 4
    see all
  • Function
    E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the RBR family. RNF144 subfamily.
    Contains 1 IBR-type zinc finger.
    Contains 2 RING-type zinc fingers.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160650 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160650 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160650.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up