Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQC IFCTACLKQYMQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQF QLYQRLKFEREVHLDPYRTWCPVADCQTVCPVASSDPGQPVLVECPSCHL KFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAEAPIKQCPVCRVYI ERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRAS VMWNRTQVVGILVGLGIIALVTSPLLLASPCIICCVCKSCRGKKKKHDPS TT
    • Amino acids
      1 to 302
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166048 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as IBRDC2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA528A10.3
    • E3 ubiquitin protein ligase RNF144B
    • E3 ubiquitin-protein ligase RNF144B
    • IBR domain containing 2
    • IBR domain containing protein 2
    • IBR domain-containing protein 2
    • IBRDC 2
    • IBRDC2
    • KIAA0161
    • MGC71786
    • OTTHUMP00000016079
    • OTTHUMP00000016080
    • OTTHUMP00000039360
    • p53 inducible RING finger protein
    • p53-inducible RING finger protein
    • p53RFP
    • PIR2
    • R144B_HUMAN
    • Ring finger 144B
    • RING finger protein 144B
    • RNF 144B
    • RNF144B
    see all
  • Function
    E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2, thereby promoting their degradation. Induces apoptosis via a p53/TP53-dependent but caspase-independent mechanism. However, its overexpression also produces a decrease of the ubiquitin-dependent stability of BAX, a pro-apoptotic protein, ultimately leading to protection of cell death; But, it is not an anti-apoptotic protein per se.
  • Tissue specificity
    Broadly expressed, with lowest levels in brain and thymus, and highest levels detectable in heart, ovary and testis.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the RBR family. RNF144 subfamily.
    Contains 1 IBR-type zinc finger.
    Contains 2 RING-type zinc fingers.
  • Domain
    The RING-type zinc finger domain mediates binding to an E2 ubiquitin-conjugating enzyme (By similarity). The transmembrane domain is essential for translocation to the mitochondria upon induction of apoptosis.
  • Post-translational
    modifications
    Auto-ubiquitinated.
  • Cellular localization
    Mitochondrion membrane. Cytoplasm. Mostly cytosololic, accumulates in submitochondrial domains specifically upon apoptosis induction, in synchrony with BAX activation.
  • Information by UniProt

Images

  • ab166048 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166048 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166048.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up