Recombinant Human RNF190 protein (ab165742)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DALTEPRSSIKISAFKCDSKLPAIDQTSVKQKHKSTMTVRKAEKVDPSEP SPADQAPMVLLRKRKPNLRRFTVSPESHSPRASGDRSRQKQQWPAKVPVP RGADQVVQQ
    • Amino acids
      76 to 184
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ35757
    • MARCH 10
    • MARCH X
    • MARCH-X
    • MARCH10
    • MARHA_HUMAN
    • Membrane associated ring finger (C3HC4) 10
    • Membrane associated ring finger (C3HC4) 10, E3 ubiquitin protein ligase
    • Membrane associated ring finger 10
    • Membrane associated RING finger protein 10
    • Membrane-associated RING finger protein 10
    • Membrane-associated RING-CH protein X
    • Probable E3 ubiquitin protein ligase MARCH10
    • Probable E3 ubiquitin-protein ligase MARCH10
    • RING finger protein 190
    • RNF 190
    • RNF190
    see all
  • Function
    E3 ubiquitin-protein ligase (Probable). E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-CH-type zinc finger.
  • Domain
    The RING-CH-type zinc finger domain is required for E3 ligase activity.
  • Information by UniProt

Images

  • ab165742 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165742 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165742.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up