Overview

  • Product name
    Recombinant Human RNF217 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSST KPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHE
    • Amino acids
      2 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165679 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as IBRDC1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C6orf172
    • dJ84N20.1
    • IBR domain containing 1
    • IBR domain containing protein 1
    • IBRDC1
    • MGC26996
    • Probable E3 ubiquitin protein ligase RNF217
    • RING finger protein 217
    • RNF217
    see all
  • Relevance
    RNF217 is an E3 ubiquitin protein ligase which accepts ubiquitin from E2 ubiquitin conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
  • Cellular localization
    Membrane; Single pass membrane protein.

Images

  • ab165679 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165679 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165679.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up