Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SVPIWPFQCYNYGVLGSQYFSSGKHYWEVDVSKKTAWILGVYCRTYSRHM KYVVRRCANRQNLYTKYRPLFGYWVIGLQNKCKYGVFEESL
    • Amino acids

      325 to 415
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as RNF21

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • IFP1
    • Interferon Responsive Finger Protein 1
    • Ring Finger Protein 21
    • Ring finger protein 21 interferon responsive
    • RNF21
    • TRIM 34
    • TRIM34
    • Tripartite motif containing protein 34
    see all
  • Relevance

    RNF21 (TRIM34) is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Expression of the TRIM34 gene is up-regulated by interferon.
  • Cellular localization

    cytoplasm

Images

  • ab162705 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162705 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up