Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEEELAIQQGQLETTLKELQTLRNMQKEAIAAHKENKLHLQQHVSMEFLK LHQFLHSKEKDILTELREEGKALNEEMELNLSQLQEQCLLAKDMLVSIQA KTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLGQYKGPIQYM VWREMQDTLCPGLSPLTLDPKTAHPNLVLSKSQTSVWHGDIKKIMPDDPE RFDSSVAVLGSRGFTSGKWYWEVEVAKKTKWTVGVVRESIIRKGSCPLTP EQGFWLLRLRNQTDLKALDLPSFSLTLTNNLDKVGIYLDYEGGQLSFYNA KTMTHIYTFSNTFMEKLYPYFCPCLNDGGENKEPLHILHPQ
    • Amino acids
      1 to 341
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165470 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin protein ligase TRIM69
    • HSD34
    • RFP like domain containing protein trimless
    • RFP-like domain-containing protein trimless
    • RING finger protein 36
    • RNF36
    • TRI69_HUMAN
    • Trif
    • Trim69
    • Trimless
    • Tripartite motif containing 69
    • tripartite motif containing protein 69
    • tripartite motif protein 69
    • Tripartite motif-containing protein 69
    see all
  • Function
    May play a role in apoptosis.
  • Sequence similarities
    Belongs to the TRIM/RBCC family.
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Phosphorylated. Phosphorylation is necessary for nuclear localization.
  • Cellular localization
    Nucleus speckle.
  • Information by UniProt

Images

  • ab165470 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165470 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165470.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up