Overview

  • Product name

    Recombinant Human RNF40 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      DETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLL MQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASD
    • Amino acids

      102 to 200
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 95 kDa retinoblastoma associated protein
    • 95 kDa retinoblastoma protein binding protein
    • 95 kDa retinoblastoma-associated protein
    • BRE 1B
    • BRE1 B
    • BRE1 E3 ubiquitin ligase homolog B
    • BRE1-B
    • BRE1B
    • BRE1B_HUMAN
    • DKFZp686K191
    • E3 ubiquitin protein ligase BRE1B
    • E3 ubiquitin-protein ligase BRE1B
    • KIAA0661
    • MGC13051
    • Rb associated protein
    • RBP 95
    • RBP95
    • RING finger protein 40
    • Ring finger protein 40 E3 ubiquitin protein ligase
    • RNF 40
    • Rnf40
    • STARING
    see all
  • Function

    E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1). H2BK120ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation (H3K4me and H3K79me, respectively). Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBE2E1/UBCH6. It thereby plays a central role in histone code and gene regulation. Required for transcriptional activation of Hox genes.
  • Tissue specificity

    Ubiquitously expressed. Expressed at higher level in testis, heart and pancreas, while it is only weakly expressed in lung, skeletal muscle and small intestine.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the BRE1 family.
    Contains 1 RING-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab160662 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up