Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTC AICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCP LCQQDWVVQRIGK
    • Molecular weight

      38 kDa including tags
    • Amino acids

      1 to 113

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CKBBP 1
    • CKBBP1
    • CKII beta binding protein 1
    • CKII beta-binding protein 1
    • Rbx 2
    • Rbx2
    • RBX2_HUMAN
    • Regulator of cullins 2
    • RING box protein 2
    • RING finger protein 7
    • RING-box protein 2
    • RNF 7
    • RNF7
    • ROC 2
    • ROC2
    • SAG
    • Sensitive to apoptosis gene
    • Sensitive to apoptosis gene protein
    • Zinc RING finger protein SAG
    see all
  • Function

    Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.
  • Tissue specificity

    Expressed in heart, liver, skeletal muscle and pancreas. At very low levels expressed in brain, placenta and lung.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the RING-box family.
    Contains 1 RING-type zinc finger.
  • Domain

    The RING-type zinc finger domain is essential for ubiquitin ligase activity. It coordinates an additional third zinc ion.
  • Post-translational
    modifications

    Phosphorylation by CK2 is required for efficient degradation of NFKBIA and CDKN1B.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132407 stained with Coomassie Blue.

References

ab132407 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up